Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | CD44 Rabbit mAb |
---|---|
Catalog No. | A19020 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC52411 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3). |
---|---|
Sequence | AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV |
Gene ID | |
Swiss Prot | |
Synonyms | IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; H-CAM; HCELL; ECM-III; HUTCH-1; HUTCH-I; ECMR-III; Hermes-1; CD44 |
Calculated MW | 82kDa |
Observed MW | 82kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Flow Cytometry |
Positive samples | HeLa, HUVEC |
Cellular location | Cell membrane, Single-pass type I membrane protein. |
Customer validation | WB(Homo sapiens, Mus musculus) FC(Homo sapiens) IHC(Homo sapiens) IHC(Homo sapiens) IF(Homo sapiens) IF(Homo sapiens,Rattus norvegicus, Mus musculus) WB(Mus musculus) IF(Homo sapiens) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19020? Please let us know so that we can cite the reference in this datasheet.