제품 > 항체 > 단일클론항체(mAb)

ATG12 Rabbit mAb (A19610)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using ATG12 antibody (A19610) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	ATG12 Rabbit mAb
Catalog No.	A19610
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0089

Background

Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 41-140 of human Apg12 (O94817).
Sequence	SPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Gene ID
Swiss Prot
Synonyms	APG12; FBR93; APG12L; HAPG12
Calculated MW	15kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	PC-3, Mouse brain, Mouse stomach
Cellular location	Cytoplasm, Peripheral membrane protein, Preautophagosomal structure membrane
Customer validation	WB(Rattus norvegicus, Mus musculus)