제품 > 항체 > 다중클론항체(pAb)

ATG12 Rabbit pAb (A15609)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using ATG12 antibody (A15609) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunofluorescence - ATG12 Rabbit pAb (A15609)

Immunofluorescence analysis of NIH/3T3 cells using ATG12 Rabbit pAb (A15609) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using ATG12 Rabbit pAb (A15609) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using ATG12 Rabbit pAb (A15609) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	ATG12 Rabbit pAb
Catalog No.	A15609
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATG12 (NP_004698.3).
Sequence	MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQL
Gene ID
Swiss Prot
Synonyms	APG12; FBR93; APG12L; HAPG12
Calculated MW	15kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HCT116, C6, Rat testis
Cellular location	Cytoplasm, Peripheral membrane protein, Preautophagosomal structure membrane
Customer validation	IF(Mus musculus) WB(Rattus norvegicus)