제품 > 항체 > 단일클론항체(mAb)

ATG12 Rabbit mAb (A22788)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using ATG12 Rabbit mAb (A22788) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - ATG12 Rabbit mAb (A22788)

Immunohistochemistry analysis of paraffin-embedded mouse lung using ATG12 Rabbit mAb (A22788) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - ATG12 Rabbit mAb (A22788)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg ATG12 antibody (A22788). Western blot was performed from the immunoprecipitate using ATG12 antibody (A22788) at a dilution of 1:500.

Overview

Product name	ATG12 Rabbit mAb
Catalog No.	A22788
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2663

Background

Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATG12 (NP_004698.3).
Sequence	MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQL
Gene ID
Swiss Prot
Synonyms	APG12; FBR93; APG12L; HAPG12; ATG12
Calculated MW	15kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HCT 116, 293T
Cellular location	Cytoplasm, Peripheral membrane protein, Preautophagosomal structure membrane