제품 > 항체 > 단일클론항체(mAb)

Argonaute-2 Rabbit mAb (A19709)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Argonaute-2 Rabbit mAb (A19709) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Argonaute-2 Rabbit mAb (A19709)

Immunohistochemistry analysis of paraffin-embedded rat brain using Argonaute-2 Rabbit mAb (A19709) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse liver tissue using Argonaute-2 Rabbit mAb (A19709) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded rat kidney tissue using Argonaute-2 Rabbit mAb (A19709) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded rat liver tissue using Argonaute-2 Rabbit mAb (A19709) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	Argonaute-2 Rabbit mAb
Catalog No.	A19709
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0189

Background

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Argonaute-2 (Q9UKV8).
Sequence	QRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV
Gene ID
Swiss Prot
Synonyms	PPD; Q10; CASC7; EIF2C2; LESKRES; LINC00980; Ago 2; Argonaute-2
Calculated MW	97kDa
Observed MW	97kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, U-87MG, MCF7, HepG2, Mouse kidney, Rat liver
Cellular location	Cytoplasm, Nucleus, P-body
Customer validation	WB(Homo sapiens) IP(Homo sapiens, Other) RIP(Homo sapiens)