제품 > 항체 > 단일클론항체(mAb)

CD137 Rabbit mAb (A26248)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of various lysates using CD137 Rabbit mAb (A26248)at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Mouse skeletal muscle
Exposure time: 30s.

ABclonal:Immunofluorescence - CD137 Rabbit mAb (A26248)

Confocal imaging of Mouse splenocytes cells using CD137 Rabbit mAb (A26248, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Overview

Product name	CD137 Rabbit mAb
Catalog No.	A26248
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC69317

Background

Enables cytokine binding activity; identical protein binding activity; and signaling receptor activity. Acts upstream of or within negative regulation of interleukin-10 production; negative regulation of interleukin-12 production; and regulation of cell population proliferation. Located in external side of plasma membrane and extracellular space. Is expressed in renal vasculature. Orthologous to human TNFRSF9 (TNF receptor superfamily member 9).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-187 of mouse CD137 (NP_001070977.1).
Sequence	VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL
Gene ID
Swiss Prot
Synonyms	ILA; Ly63; 4-1BB; Cd137; CDw137; A930040I11Rik
Calculated MW	28kDa
Observed MW	24-28kDa, 40-50kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse placenta
Cellular location	Cell membrane.