제품 > 항체 > 다중클론항체(pAb)

CD147/BSG Rabbit pAb (A1566)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CD147/BSG Rabbit pAb (A1566) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from HepG2 cells, using CD147/BSG Rabbit pAb (A1566) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - CD147/BSG Rabbit pAb (A1566)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using CD147/CD147/BSG Rabbit pAb (A1566) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using CD147/CD147/BSG Rabbit pAb (A1566) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human cervix cancer using BSG Rabbit pAb (A1566) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta using BSG Rabbit pAb (A1566) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - CD147/BSG Rabbit pAb (A1566)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg CD147/BSG antibody (A1566). Western blot was performed from the immunoprecipitate using CD147/BSG antibody (A1566) at a dilution of 1:1000.

Immunoprecipitation of CD147/BSG in 200 µg extracts from Hep G2 cells using 0.5 µg CD147/BSG Rabbit pAb (A1566). Western blot analysis was performed using CD147/BSG Rabbit pAb (A1566) at 1:2000 dilution.

Overview

Product name	CD147/BSG Rabbit pAb
Catalog No.	A1566
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD147/CD147/BSG (NP_001719.2).
Sequence	HIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
Gene ID
Swiss Prot
Synonyms	OK; 5F7; TCSF; CD147; EMPRIN; HAb18G; EMMPRIN; CD147/BSG
Calculated MW	42kDa
Observed MW	38-65kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	Y79, Mouse brain, Rat brain
Cellular location	Cell membrane, Melanosome, Single-pass type I membrane protein.
Customer validation	WB(Homo sapiens) IF(Homo sapiens)