Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Western blot analysis of lysates from wild type (WT) and CD147/CD147/BSG knockout (KO) 293T cells, using [KO Validated] CD147/BSG Rabbit pAb (A18032) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of lysates from L-02 cells using CD147/BSG Rabbit pAb (A18032) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
| Product name | [KO Validated] CD147/BSG Rabbit pAb |
|---|---|
| Catalog No. | A18032 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 45-200 of human CD147/CD147/BSG (NP_940991.1). |
|---|---|
| Sequence | DSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | OK; 5F7; TCSF; CD147; EMPRIN; HAb18G; EMMPRIN; SG |
| Calculated MW | 42kDa |
| Observed MW | 48-58kDa |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | 293T |
| Cellular location | Cell membrane, Melanosome, Single-pass type I membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
![ABclonal:Western blot - [KO Validated] CD147/BSG Rabbit pAb (A18032)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A18032_Q2807(KO)_KO-WB_01.jpg?t=1718352626 "ABclonal:Western blot - [KO Validated] CD147/BSG Rabbit pAb (A18032)")
![ABclonal:Western blot - [KO Validated] CD147/BSG Rabbit pAb (A18032)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A18032_Q2807_WB_01.jpg?t=1718352626 "ABclonal:Western blot - [KO Validated] CD147/BSG Rabbit pAb (A18032)")
