제품 > 항체 > 단일클론항체(mAb)

CD32 Rabbit mAb (A26173)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using CD32 Rabbit mAb (A26173) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Flow CytoMetry - CD32 Rabbit mAb (A26173)

Flow cytometry: 1X10^6 bEnd.3 cells (negative control, left) and C57BL/6 mouse splenocytes (right) were surface-stained with CD32 Rabbit mAb (A26173, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by APC conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD32 Rabbit mAb (A26173, 2 μg/mL, right), followed by APC conjugated goat anti-rabbit pAb staining.

Overview

Product name	CD32 Rabbit mAb
Catalog No.	A26173
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68229

Background

CD32 (Fcgr2) is a 40 kD transmembrane glycoprotein, member of the immunoglobulin superfamily. The extracellular region of CD32 consists of two Ig C-type domains that binds the Fc region from monomeric IgG with low affinity, but binds immune complexes efficiently. CD32 can mediate phagocytosis of immune complexes and modulate cell activation. CD32 is expressed by Macrophages, neutrophils, mast cells and B cells.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-207 of mouse CD32 (NP_034317.1).
Sequence	THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSR
Gene ID
Swiss Prot
Synonyms	CD32; Fcgr2; Fcr-2; Fcr-3; Ly-17; LyM-1; Lym-1; fcRII; FcgRII; Fcgr2a; Ly-m20; Fc[g]RII; F630109E10Rik
Calculated MW	31kDa/33kDa/36kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200 FC 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3
Key application	Immunohistochemistry Flow Cytometry
Positive samples
Cellular location	Cell membrane, Cytoplasm, cytoskeleton, Secreted