제품 > 항체 > 단일클론항체(mAb)

FITC Rabbit anti-Mouse CD32 mAb (A26136)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 bEnd.3 cells (negative control, left) and C57BL/6 mouse splenocytes (right) were surface-stained with FITC Rabbit anti-Mouse CD32 mAb (A26136, 5 μl/Test, orange line) or FITC Rabbit IgG isotype control (A25616, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with FITC Rabbit IgG isotype control (A25616, 5 μl/Test, left) or FITC Rabbit anti-Mouse CD32 mAb (A26136, 5 μl/Test, right).

Flow cytometry:1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 647 Rabbit anti-Mouse CD19 mAb (A24101, 5 μl/Test) and FITC Rabbit anti-Mouse CD32 mAb (A26136, 5 μl/Test, right) or FITC Rabbit IgG isotype control (A25616, 5 μl/Test, left).

Overview

Product name	FITC Rabbit anti-Mouse CD32 mAb
Catalog No.	A26136
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68229-FITC

Background

CD32 (Fcgr2) is a 40 kD transmembrane glycoprotein, member of the immunoglobulin superfamily. The extracellular region of CD32 consists of two Ig C-type domains that binds the Fc region from monomeric IgG with low affinity, but binds immune complexes efficiently. CD32 can mediate phagocytosis of immune complexes and modulate cell activation. CD32 is expressed by Macrophages, neutrophils, mast cells and B cells.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-207 of mouse CD32 (NP_034317.1).
Sequence	THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSR
Gene ID
Swiss Prot
Synonyms	CD32; Fcgr2; Fcr-2; Fcr-3; Ly-17; LyM-1; Lym-1; fcRII; FcgRII; Fcgr2a; Ly-m20; Fc[g]RII; F630109E10Rik
Calculated MW	31kDa/33kDa/36kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Cytoplasm, cytoskeleton, Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FITC Rabbit anti-Mouse CD32 mAb images

Flow CytoMetry - FITC Rabbit anti-Mouse CD32 mAb (A26136)

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with FITC Rabbit IgG isotype control (A25616, 5 μl/Test, left) or FITC Rabbit anti-Mouse CD32 mAb (A26136, 5 μl/Test, right).

Flow CytoMetry - FITC Rabbit anti-Mouse CD32 mAb (A26136)

* For research use only. Not for therapeutic or diagnostic purposes.