제품 > 항체 > 단일클론항체(mAb)

CD62P/P-selectin Rabbit mAb (A4989)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CD62P/P-selectin Rabbit mAb (A4989) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - CD62P/P-selectin Rabbit mAb (A4989)

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using CD62P/P-selectin Rabbit mAb (A4989) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using CD62P/P-selectin Rabbit mAb (A4989) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CD62P/P-selectin Rabbit mAb (A4989) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	CD62P/P-selectin Rabbit mAb
Catalog No.	A4989
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1229

Background

This gene encodes a 140 kDa protein that is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. This protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interaction of activated endothelial cells or platelets with leukocytes. The membrane protein is a calcium-dependent receptor that binds to sialylated forms of Lewis blood group carbohydrate antigens on neutrophils and monocytes. Alternative splice variants may occur but are not well documented.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 731-830 of human CD62P/P-selectin (P16109).
Sequence	SFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVASTIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
Gene ID
Swiss Prot
Synonyms	CD62; GRMP; PSEL; CD62P; GMP140; LECAM3; PADGEM; CD62P/P-selectin
Calculated MW	91kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	A549, Jurkat, Mouse lung, Mouse liver, Mouse spleen, Rat lung, Rat liver
Cellular location	Membrane, Single-pass type I membrane protein.
Customer validation	WB(Homo sapiens)