제품 > 항체 > 단일클론항체(mAb)

CD68 Rabbit mAb (A22329)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using CD68 Rabbit mAb (A22329) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - CD68 Rabbit mAb (A22329)

Immunohistochemistry analysis of paraffin-embedded Human colon using CD68 Rabbit mAb (A22329) at dilution of 1:70000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using CD68 Rabbit mAb (A22329) at dilution of 1:70000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	CD68 Rabbit mAb
Catalog No.	A22329
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51158

Background

This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2).
Sequence	TSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK
Gene ID
Swiss Prot
Synonyms	GP110; LAMP4; SCARD1; CD68
Calculated MW	37kDa
Observed MW	70-80kDa, 130-140kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:10000 - 1:80000 FC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	THP-1, U-937, Mouse spleen, Rat lung
Cellular location	Cell membrane, Endosome membrane, Lysosome membrane, Single-pass type I membrane protein, Single-pass type I membrane protein.
Customer validation	IHC(Mus musculus) Other(Rattus norvegicus)