제품 > 항체 > 다중클론항체(pAb)

CD68 Rabbit pAb (A20555)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from RAW264.7 cells, using CD68 Rabbit pAb (A20555) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from Raji cells, using CD68 Rabbit pAb (A20555) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - CD68 Rabbit pAb (A20555)

Immunofluorescence analysis of RAW 264 7 and Jurkat(Negative sample) cells using CD68 Rabbit pAb (A20555) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of THP-1 cells using CD68 Rabbit pAb (A20555) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	CD68 Rabbit pAb
Catalog No.	A20555
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in several processes, including cellular response to lipopolysaccharide; cellular response to oxidised low-density lipoprotein particle stimulus; and negative regulation of dendritic cell antigen processing and presentation. Acts upstream of or within aging and cellular response to organic substance. Located in lysosome and plasma membrane. Is expressed in several structures, including central nervous system; embryo mesenchyme; heart blood vessel; liver; and spleen. Orthologous to human CD68 (CD68 molecule).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of mouse CD68 (NP_001277987.1).
Sequence	SHRPTTTSHGNVTVHTSSGPTTVTHNPATTTSHGNATISHATVSPTTNGTATSPRSSTVGPHPGPPPPSPSPRSKGALGNYTWANGSQPCVQLQAQIQIRI
Gene ID
Swiss Prot
Synonyms	Lamp4; gp110; Scard1; CD68
Calculated MW	35kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Raji, RAW264.7
Cellular location	lysosome, plasma membrane.