Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | CD81 Rabbit mAb |
---|---|
Catalog No. | A4863 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0615 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD81 (P60033). |
---|---|
Sequence | ILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSG |
Gene ID | |
Swiss Prot | |
Synonyms | S5.7; CVID6; TAPA1; TSPAN28; CD81 |
Calculated MW | 26kDa |
Observed MW | 22kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse liver, Rat liver |
Cellular location | Membrane, Multi-pass membrane protein. |
Customer validation | WB(Homo sapiens, Mus musculus, Sus scrofa) Other(Mus musculus) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4863? Please let us know so that we can cite the reference in this datasheet.