Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CD86 Rabbit mAb |
---|---|
Catalog No. | A19026 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0333 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD86 (P42081). |
---|---|
Sequence | MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNL |
Gene ID | |
Swiss Prot | |
Synonyms | B70; B7-2; B7.2; LAB72; CD28LG2; CD86 |
Calculated MW | 38kDa |
Observed MW | 80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Raji, Jurkat, U-251MG, Mouse spleen, Mouse liver, Rat thymus |
Cellular location | Cell membrane, Single-pass type I membrane protein. |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus, Mus musculus) IF(Macaca mulatta) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19026? Please let us know so that we can cite the reference in this datasheet.