제품 > 항체 > 다중클론항체(pAb)

CDX2 Rabbit pAb (A16816)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Immunohistochemistry analysis of CDX2 in paraffin-embedded rat colon tissue using CDX2 Rabbit pAb (A16816) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of CDX2 in paraffin-embedded human colon tissue using CDX2 Rabbit pAb (A16816) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of CDX2 in paraffin-embedded mouse colon tissue using CDX2 Rabbit pAb (A16816) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Overview

Product name	CDX2 Rabbit pAb
Catalog No.	A16816
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis.

Immunogen information

Immunogen	Recombinant Protein corresponding to a sequence within amino acids 1-180 of human CDX2 (NP_001256.3).
Sequence	MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ
Gene ID
Swiss Prot
Synonyms	CDX3; CDX-3; CDX2/AS; CDX2
Calculated MW	34kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples
Cellular location	Nucleus