제품 > 항체 > 단일클론항체(mAb)

[KD Validated] CDX2 Rabbit mAb (A19030)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KD Validated] CDX2 Rabbit mAb (A19030) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of lysates from wild type(WT) and CDX2 knockdown (KD) 293T cells, using [KD Validated] CDX2 Rabbit mAb (A19030) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - [KD Validated] CDX2 Rabbit mAb (A19030)

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using [KD Validated] CDX2 Rabbit mAb (A19030) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KD Validated] CDX2 Rabbit mAb (A19030) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using [KD Validated] CDX2 Rabbit mAb (A19030) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using [KD Validated] CDX2 Rabbit mAb (A19030) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KD Validated] CDX2 Rabbit mAb (A19030) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KD Validated] CDX2 Rabbit mAb (A19030)

Confocal imaging of Human colon using [KD Validated] CDX2 Rabbit mAb (A19030, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

ABclonal:Immunoprecipitation - [KD Validated] CDX2 Rabbit mAb (A19030)

Immunoprecipitation analysis of 600 μg extracts of 293T cells using 3 μg [KD Validated] CDX2 Rabbit mAb (A19030). Western blot was performed from the immunoprecipitate using CDX2 antibody (A19030) at a dilution of 1:500.

Overview

Product name	[KD Validated] CDX2 Rabbit mAb
Catalog No.	A19030
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0450

Background

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDX2 (Q99626).
Sequence	MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGS
Gene ID
Swiss Prot
Synonyms	CDX3; CDX-3; CDX2/AS; X2
Calculated MW	34kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:500 - 1:2000 IF/ICC 1:100 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	SW480, 293T
Cellular location	Nucleus.
Customer validation	IF(Mus musculus) IHC(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구후성유전학 & 핵 신호전달전사 인자

[KD Validated] CDX2 Rabbit mAb images

Western blot - [KD Validated] CDX2 Rabbit mAb (A19030)

Immunohistochemistry - [KD Validated] CDX2 Rabbit mAb (A19030)

Immunofluorescence - [KD Validated] CDX2 Rabbit mAb (A19030)

Confocal imaging of Human colon using [KD Validated] CDX2 Rabbit mAb (A19030, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

Immunoprecipitation - [KD Validated] CDX2 Rabbit mAb (A19030)

* For research use only. Not for therapeutic or diagnostic purposes.