제품 > 항체 > 다중클론항체(pAb)

CLDN4 Rabbit pAb (A12912)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using CLDN4 Rabbit pAb (A12912) at 1:4000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HL-60
Exposure time: 30s.

ABclonal:Immunohistochemistry - CLDN4 Rabbit pAb (A12912)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using CLDN4 Rabbit pAb (A12912) at dilution of 1:150 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	CLDN4 Rabbit pAb
Catalog No.	A12912
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 109-209 of human CLDN4 (NP_001296.1).
Sequence	EDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Gene ID
Swiss Prot
Synonyms	CPER; CPE-R; CPETR; CPETR1; WBSCR8; hCPE-R; CLDN4
Calculated MW	22kDa
Observed MW	18kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:4000 IHC-P 1:50 - 1:100 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	PC-3, MCF7
Cellular location	Cell junction, Cell membrane, Multi-pass membrane protein, tight junction.
Customer validation	WB(Homo sapiens)