제품 > 항체 > 단일클론항체(mAb)

Claudin-4 Rabbit mAb (A23841)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using Claudin-4 Rabbit mAb (A23841) at 1:7000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HAP1
Exposure time: 20s.

ABclonal:Immunohistochemistry - Claudin-4 Rabbit mAb (A23841)

Immunohistochemistry analysis of paraffin-embedded Human breast tissue using Claudin-4 Rabbit mAb (A23841) at dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Claudin-4 Rabbit mAb (A23841) at dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunoprecipitation - Claudin-4 Rabbit mAb (A23841)

Immunoprecipitation of Claudin-4 from 500 µg extracts of MCF7 cells was performed using 2 µg of Claudin-4 Rabbit mAb (A23841). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X non-reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using Claudin-4 Rabbit mAb (A23841) at a dilution of 1:5000.

Overview

Product name	Claudin-4 Rabbit mAb
Catalog No.	A23841
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61052

Background

The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 111-209 of human Claudin-4 (NP_001296.1).
Sequence	DESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Gene ID
Swiss Prot
Synonyms	CLDN4; CPE-R; CPER; CPETR; CPETR1; WBSCR8; hCPE-R; claudin-4; Claudin-4
Calculated MW	22kDa
Observed MW	18kDa/

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:7000 - 1:28000 IHC-P 1:1000 - 1:3000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	MCF7, PC-3, MCF7
Cellular location	Cell junction, Cell membrane, Multi-pass membrane protein, tight junction.
Customer validation	IHC(Mus musculus)