Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | CREB Rabbit mAb |
---|---|
Catalog No. | A10826 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0113 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CREB1 (P16220). |
---|---|
Sequence | ATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR |
Gene ID | |
Swiss Prot | |
Synonyms | CREB; CREB-1 |
Calculated MW | 35kDa |
Observed MW | 43kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse lung, Mouse brain, Rat brain |
Cellular location | Nucleus. |
Customer validation | IF(Mus musculus) WB(Rattus norvegicus, Homo sapiens, Mus musculus, Mus musculus, Other) IHC(Homo sapiens) IF(Homo sapiens, Mus musculus) IP(Homo sapiens, Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10826? Please let us know so that we can cite the reference in this datasheet.