제품 > 항체 > 단일클론항체(mAb)

CXCL1 Rabbit mAb (A25014)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of recombinant mouse CXCL1/GRO-alpha Protein using CXCL1 Rabbit mAb (A25014) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 5ng/1ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	CXCL1 Rabbit mAb
Catalog No.	A25014
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65165

Background

This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. In mouse, deficiency of this gene is associated with colitis and with defects in immune cell recruitment to the lung.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-96 of mouse CXCL1(NP_032202.1).
Sequence	APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Gene ID
Swiss Prot
Synonyms	KC; Fsp; N51; gro; Gro1; Mgsa; Scyb1; CXCL1
Calculated MW	10kDa
Observed MW	45kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Recombinant mouse CXCL1/GRO-alpha Protein
Cellular location	Secreted