제품 > 항체 > 다중클론항체(pAb)

CXCL9 Rabbit pAb (A1864)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using CXCL9 Rabbit pAb (A1864) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	CXCL9 Rabbit pAb
Catalog No.	A1864
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human CXCL9 (NP_002407.1).
Sequence	KQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Gene ID
Swiss Prot
Synonyms	CMK; MIG; Humig; SCYB9; crg-10; CXCL9
Calculated MW	14kDa
Observed MW	14kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	THP-1, A-431, 293T
Cellular location	Secreted.
Customer validation	WB(Mus musculus, Homo sapiens) IHC(Homo sapiens) ELISA(Homo sapiens) IHC(Homo sapiens) WB(Homo sapiens)