Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | CXCL9 Rabbit pAb |
---|---|
Catalog No. | A1864 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human CXCL9 (NP_002407.1). |
---|---|
Sequence | KQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
Gene ID | |
Swiss Prot | |
Synonyms | CMK; MIG; Humig; SCYB9; crg-10; CXCL9 |
Calculated MW | 14kDa |
Observed MW | 14kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | THP-1, A-431, 293T |
Cellular location | Secreted. |
Customer validation | WB(Mus musculus, Homo sapiens) IHC(Homo sapiens) ELISA(Homo sapiens) IHC(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1864? Please let us know so that we can cite the reference in this datasheet.