제품 > 항체 > 다중클론항체(pAb)

Casein Kinase 2 beta (CSNK2B) Rabbit pAb (A14722)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb (A14722) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - Casein Kinase 2 beta (CSNK2B) Rabbit pAb (A14722)

Immunofluorescence analysis of NIH-3T3 cells using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Polyclonal Antibody (A14722) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Polyclonal Antibody (A14722) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Casein Kinase 2 beta (CSNK2B) Rabbit pAb
Catalog No.	A14722
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) (NP_001311.3).
Sequence	MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Gene ID
Swiss Prot
Synonyms	G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B; POBINDS
Calculated MW	25kDa
Observed MW	25kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	U-87MG, HeLa, SW620, MCF7, Mouse spleen, Mouse kidney, Mouse testis, Rat brain
Cellular location	cytoplasm, cytosol, extracellular exosome, extracellular region, nucleoplasm, nucleus
Customer validation	WB(Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Casein Kinase 2 beta (CSNK2B) Rabbit pAb images

Western blot - Casein Kinase 2 beta (CSNK2B) Rabbit pAb (A14722)

Immunofluorescence - Casein Kinase 2 beta (CSNK2B) Rabbit pAb (A14722)

Immunofluorescence analysis of NIH-3T3 cells using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Polyclonal Antibody (A14722) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - Casein Kinase 2 beta (CSNK2B) Rabbit pAb (A14722)

Immunofluorescence analysis of U-2 OS cells using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Polyclonal Antibody (A14722) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.