제품 > 항체 > 다중클론항체(pAb)

Casein Kinase 2 beta (CSNK2B) Rabbit pAb (A17467)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb (A17467) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Casein Kinase 2 beta (CSNK2B) Rabbit pAb (A17467)

Immunohistochemistry analysis of paraffin-embedded rat lung using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb (A17467) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb (A17467) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse testis using Casein Kinase 2 beta (Casein Kinase 2 beta (CSNK2B)) Rabbit pAb (A17467) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	Casein Kinase 2 beta (CSNK2B) Rabbit pAb
Catalog No.	A17467
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human Casein Kinase 2 beta (CSNK2B)) (NP_001311.3).
Sequence	MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Gene ID
Swiss Prot
Synonyms	G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B; POBINDS
Calculated MW	25kDa
Observed MW	25kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	SW620, HeLa, Mouse spleen
Cellular location	cytoplasm, cytosol, extracellular exosome, extracellular region, nucleoplasm, nucleus