Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Caspase-8 Rabbit pAb |
---|---|
Catalog No. | A11450 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Caspase-8 (NP_203519.1). |
---|---|
Sequence | QLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFL |
Gene ID | |
Swiss Prot | |
Synonyms | CAP4; MACH; MCH5; FLICE; ALPS2B; Casp-8; Caspase-8 |
Calculated MW | 55kDa |
Observed MW | 57kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat, Mouse liver, Rat thymus |
Cellular location | Cytoplasm. |
Customer validation | WB(Bos taurus, Homo sapiens, Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11450? Please let us know so that we can cite the reference in this datasheet.