Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Cleaved GSDME (N Terminal) Rabbit mAb |
---|---|
Catalog No. | A23072 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC56582 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Cleaved GSDME (N Terminal)(NP_004394.1). |
---|---|
Sequence | NVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPDAAHGISSQDGPLSVLKQATLLLERNFHPFA |
Gene ID | |
Swiss Prot | |
Synonyms | DFNA5; ICERE-1; Cleaved GSDME (N Terminal) |
Calculated MW | 55kDa |
Observed MW | 32kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SH-SY5Y treated by Etoposide, Ncl-H522 treated by Doxorubicin |
Cellular location | Cytoplasm, Cytosol, Plasma membrane |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23072? Please let us know so that we can cite the reference in this datasheet.