제품 > 항체 > 단일클론항체(mAb)

Cleaved GSDME (N Terminal) Rabbit mAb (A23072)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from SH-SY5Y cells, using Cleaved GSDME (N Terminal) Rabbit mAb (A23072) at 1:1000 dilution. SH-SY5Y cells were treated by Etoposide (25 uM) at 37℃ for 5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of lysates from Ncl-H522 cells, using Cleaved GSDME (N Terminal) Rabbit mAb (A23072) at 1:1000 dilution. Ncl-H522 cells were treated by Doxorubicin (0. 5 uM) at 37℃ for 24 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	Cleaved GSDME (N Terminal) Rabbit mAb
Catalog No.	A23072
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC56582

Background

Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Cleaved GSDME (N Terminal)(NP_004394.1).
Sequence	NVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPDAAHGISSQDGPLSVLKQATLLLERNFHPFA
Gene ID
Swiss Prot
Synonyms	DFNA5; ICERE-1; Cleaved GSDME (N Terminal)
Calculated MW	55kDa
Observed MW	32kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SH-SY5Y treated by Etoposide, Ncl-H522 treated by Doxorubicin
Cellular location	Cytoplasm, Cytosol, Plasma membrane
Customer validation	WB(Homo sapiens)