제품 > 항체 > 다중클론항체(pAb)

Cleaved Gasdermin B Rabbit pAb (A23046)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HT-29+NK-92, using Cleaved Gasdermin B Rabbit pAb (A23046) at 1:400 dilution.HT-29 and NK-92 cells were treated by IFNγ (50ng/ml) for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s.

Overview

Product name	Cleaved Gasdermin B Rabbit pAb
Catalog No.	A23046
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the gasdermin-domain containing protein family. Other gasdermin-family genes are implicated in the regulation of apoptosis in epithelial cells, and are linked to cancer. Alternative splicing and the use of alternative promoters results in multiple transcript variants. Additional variants have been described, but they are candidates for nonsense-mediated mRNA decay (NMD) and are unlikely to be protein-coding.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human Cleaved Gasdermin B. (NP_001159431.1).
Sequence	PPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHME
Gene ID
Swiss Prot
Synonyms	GSDML; PP4052; GSDMB-1; PRO2521; Cleaved Gasdermin B
Calculated MW	18kDa/45kDa/46kDa/47kDa
Observed MW	16kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Co-culture of HT-29 and NK-92 treated by IFNγ
Cellular location