제품 > 항체 > 다중클론항체(pAb)

DNA Ligase III/LIG3 Rabbit pAb (A1887)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using DNA Ligase III/LIG3 Rabbit pAb (A1887) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunoprecipitation - DNA Ligase III/LIG3 Rabbit pAb (A1887)

Immunoprecipitation analysis of 200 μg extracts of Jurkat cells using 1 μg DNA Ligase III/LIG3 antibody (A1887). Western blot was performed from the immunoprecipitate using DNA Ligase III/LIG3 antibody (A1887) at a dilution of 1:1000.

Overview

Product name	DNA Ligase III/LIG3 Rabbit pAb
Catalog No.	A1887
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 730-1009 of human DNA Ligase III/LIG3 (NP_039269.2).
Sequence	AGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTVVAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC
Gene ID
Swiss Prot
Synonyms	LIG2; MTDPS20; LIG3alpha; DNA Ligase III/LIG3
Calculated MW	113kDa
Observed MW	113kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	BT474, SW480, HeLa, HT-29, Jurkat
Cellular location	Mitochondrion, Mitochondrion, Nucleus.
Customer validation	WB(Homo sapiens)