제품 > 항체 > 단일클론항체(mAb)

DNA-PKcs Rabbit mAb (A20837)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using DNA-PKcs Rabbit mAb (A20837) at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - DNA-PKcs Rabbit mAb (A20837)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using DNA-PKcs Rabbit mAb (A20837) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using DNA-PKcs Rabbit mAb (A20837) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - DNA-PKcs Rabbit mAb (A20837)

Confocal imaging of HeLa cells using DNA-PKcs Rabbit mAb (A20837, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - DNA-PKcs Rabbit mAb (A20837)

Immunoprecipitation of DNA-PKcs from 300 µg extracts of HeLa cells was performed using 1 µg of DNA-PKcs Rabbit mAb (A20837). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using DNA-PKcs Rabbit mAb (A20837) at a dilution of 1:10000.

Overview

Product name	DNA-PKcs Rabbit mAb
Catalog No.	A20837
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51265

Background

This gene encodes the catalytic subunit of the DNA-dependent protein kinase (DNA-PK). It functions with the Ku70/Ku80 heterodimer protein in DNA double strand break repair and recombination. The protein encoded is a member of the PI3/PI4-kinase family.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 3993-4128 of human DNA-PKcs (NP_008835.5).
Sequence	SDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM
Gene ID
Swiss Prot
Synonyms	HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNAPKc; DNA-PKC; DNA-PKcs
Calculated MW	469kDa
Observed MW	469kDa/

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:5000 - 1:30000 IHC-P 1:200 - 1:2000 IF/ICC 1:200 - 1:1000 IP 0.5μg-4μg antibody for 200μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	MCF7, SH-SY5Y, HeLa
Cellular location	Nucleus, nucleolus.
Customer validation	WB(Homo sapiens) IF(Homo sapiens)