제품 > 항체 > 단일클론항체(mAb)

EBP1/PA2G4 Rabbit mAb (A5114)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using EBP1/PA2G4 Rabbit mAb (A5114) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of lysates from Rat brain, using EBP1/PA2G4 Rabbit mAb (A5114) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - EBP1/PA2G4 Rabbit mAb (A5114)

Immunohistochemistry analysis of EBP1/PA2G4 in paraffin-embedded human colon carcinoma tissue using EBP1/PA2G4 Rabbit mAb (A5114) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EBP1/PA2G4 in paraffin-embedded rat brain tissue using EBP1/PA2G4 Rabbit mAb (A5114) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EBP1/PA2G4 in paraffin-embedded mouse colon tissue using EBP1/PA2G4 Rabbit mAb (A5114) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EBP1/PA2G4 in paraffin-embedded human pancreas tissue using EBP1/PA2G4 Rabbit mAb (A5114) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - EBP1/PA2G4 Rabbit mAb (A5114)

Immunofluorescence analysis of NIH-3T3 cells using EBP1/PA2G4 Rabbit mAb (A5114) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	EBP1/PA2G4 Rabbit mAb
Catalog No.	A5114
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1281

Background

This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 300-394 of human EBP1/PA2G4 (NP_006182.2).
Sequence	ELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD
Gene ID
Swiss Prot
Synonyms	EBP1; HG4-1; ITAF45; p38-2G4; EBP1/PA2G4
Calculated MW	44kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, 293T, Jurkat, Mouse lung, Mouse brain, Rat brain
Cellular location	Cytoplasm, Nucleus, nucleolus