제품 > 항체 > 단일클론항체(mAb)

EIF4G2/p97 Rabbit mAb (A21193)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using EIF4G2/p97 Rabbit mAb (A21193) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from Rat lung, using EIF4G2/p97 Rabbit mAb (A21193) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - EIF4G2/p97 Rabbit mAb (A21193)

Immunohistochemistry analysis of EIF4G2/p97 in paraffin-embedded mouse brain tissue using EIF4G2/p97 Rabbit mAb (A21193) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EIF4G2/p97 in paraffin-embedded human pancreas tissue using EIF4G2/p97 Rabbit mAb (A21193) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EIF4G2/p97 in paraffin-embedded rat testis tissue using EIF4G2/p97 Rabbit mAb (A21193) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EIF4G2/p97 in paraffin-embedded human breast cancer tissue using EIF4G2/p97 Rabbit mAb (A21193) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EIF4G2/p97 in paraffin-embedded rat brain tissue using EIF4G2/p97 Rabbit mAb (A21193) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EIF4G2/p97 in paraffin-embedded mouse testis tissue using EIF4G2/p97 Rabbit mAb (A21193) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	EIF4G2/p97 Rabbit mAb
Catalog No.	A21193
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC52820

Background

Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 320-490 of human EIF4G2/p97 (NP_001409.3).
Sequence	PKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQFGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPAQSFLMNKNQVPKL
Gene ID
Swiss Prot
Synonyms	P97; AAG1; DAP5; NAT1; EIF4G2/p97
Calculated MW	102kDa
Observed MW	97kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:6000 IHC-P 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	Jurkat, HeLa, C2C12, Mouse brain, Rat lung
Cellular location	adherens junction, cytosol, eukaryotic translation initiation factor 4F complex