Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PD-L1/CD274 Rabbit pAb |
---|---|
Catalog No. | A11273 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 19-238 of human PD-L1/CD274 (NP_054862.1). |
---|---|
Sequence | FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER |
Gene ID | |
Swiss Prot | |
Synonyms | B7-H; B7H1; PDL1; PD-L1; hPD-L1; PDCD1L1; PDCD1LG1; PD-L1/CD274 |
Calculated MW | 33kDa |
Observed MW | 40-50kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | A-549 treated by IFNG, Mouse skeletal muscle, Rat skeletal muscle |
Cellular location | Cell membrane, Endomembrane system, Single-pass type I membrane protein. |
Customer validation | IF(Mus musculus, Homo sapiens) WB(Homo sapiens) IHC(Homo sapiens) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11273? Please let us know so that we can cite the reference in this datasheet.