제품 > 항체 > 다중클론항체(pAb)

ENO2 Rabbit pAb (A12341)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ENO2 Rabbit pAb (A12341) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - ENO2 Rabbit pAb (A12341)

Immunofluorescence analysis of HeLa cells using ENO2 Rabbit pAb (A12341) at dilution of 1:20 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using ENO2 Rabbit pAb (A12341) at dilution of 1:20 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Raji cells using ENO2 Rabbit pAb (A12341) at dilution of 1:20 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - ENO2 Rabbit pAb (A12341)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain cells using 3 μg ENO2 antibody (A12341). Western blot was performed from the immunoprecipitate using ENO2 antibody (A12341) at a dilution of 1:1000.

Overview

Product name	ENO2 Rabbit pAb
Catalog No.	A12341
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 195-434 of human ENO2 (NP_001966.1).
Sequence	VIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL
Gene ID
Swiss Prot
Synonyms	NSE; HEL-S-279; ENO2
Calculated MW	47kDa
Observed MW	47kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	SH-SY5Y, Mouse brain, Rat brain
Cellular location	Cell membrane, Cytoplasm.
Customer validation	WB(Ovis aries, Homo sapiens) IF(Rattus norvegicus) IHC(Homo sapiens)