제품 > 항체 > 단일클론항체(mAb)

ERK1 Rabbit mAb (A21975)

Datasheet

Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Rat

ABclonal:Western blot - ERK1 Rabbit mAb (A21975)

Western blot analysis of lysates from Rat brain, using ERK1 Rabbit mAb (A21975) at1:27000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - ERK1 Rabbit mAb (A21975)

Immunofluorescence analysis of PC-12 cells using ERK1 Rabbit mAb (A21975) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product nameERK1 Rabbit mAb
Catalog No.A21975
Host speciesRabbit
Purification methodAffinity purification
IsotypeIgG
CloneNo.ARC51164
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described.
ImmunogenA synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK1ERK1/2 (P27361/P28482).
SequenceFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD/LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
Gene ID
Swiss Prot
SynonymsERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK
Calculated MW43kDa
Observed MW44kDa
ReactivityRat
Tested applicationsWBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:10000 - 1:30000
  • IF/ICC 1:50 - 1:200
Storage bufferStore at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key applicationWestern blotting    Immunofluorescence    
Positive samplesRat brain
Cellular locationCytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

ABclonal:Western blot - ERK1 Rabbit mAb (A21975)}

Western blot - ERK1 Rabbit mAb (A21975)

Western blot analysis of lysates from Rat brain, using ERK1 Rabbit mAb (A21975) at1:27000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - ERK1 Rabbit mAb (A21975)}

Immunofluorescence - ERK1 Rabbit mAb (A21975)

Immunofluorescence analysis of PC-12 cells using ERK1 Rabbit mAb (A21975) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.

항체 (3)

ELISA 키트 (1)

Secondary Antibodies (26)