제품 > 항체 > 단일클론항체(mAb)

[KD Validated] ERK1 Rabbit mAb (A19561)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using [KD Validated] ERK1 Rabbit mAb (A19561) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from wild type(WT) and ERK1 knockdown (KD) 293T cells, using [KD Validated] ERK1 Rabbit mAb (A19561) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KD Validated] ERK1 Rabbit mAb (A19561)

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using [KD Validated] ERK1 Rabbit mAb (A19561) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human brain tissue using [KD Validated] ERK1 Rabbit mAb (A19561) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human breast tissue using [KD Validated] ERK1 Rabbit mAb (A19561) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KD Validated] ERK1 Rabbit mAb (A19561)

Confocal imaging of MCF7 cells using [KD Validated] ERK1 Rabbit mAb (A19561, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of paraffin-embedded 5xFAD mouse brain tissue using [KD Validated] ERK1 Rabbit mAb (A19561, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunoprecipitation - [KD Validated] ERK1 Rabbit mAb (A19561)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg [KD Validated] ERK1 Rabbit mAb (A19561). Western blot was performed from the immunoprecipitate using ERK1 antibody (A19561) at a dilution of 1:1000.

Overview

Product name	[KD Validated] ERK1 Rabbit mAb
Catalog No.	A19561
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2591

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERK1 (P27361).
Sequence	MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENV
Gene ID
Swiss Prot
Synonyms	ERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK; K1
Calculated MW	43kDa
Observed MW	44kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:2000 IF/ICC 1:100 - 1:800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T, HeLa, HT-29
Cellular location	Cytoplasm, Nucleus.
Customer validation	WB(Rattus norvegicus, Homo sapiens, Mus musculus, Mus musculus)