Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | EZH2/KMT6 Rabbit mAb |
---|---|
Catalog No. | A19577 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0056 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 148-272 of human EZH2/KMT6 (Q15910). |
---|---|
Sequence | ELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSV |
Gene ID | |
Swiss Prot | |
Synonyms | WVS; ENX1; KMT6; WVS2; ENX-1; EZH2b; KMT6A; EZH2/KMT6 |
Calculated MW | 85kDa |
Observed MW | 98kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Jurkat, HeLa |
Cellular location | Nucleus. |
Customer validation | WB(Mus musculus, Homo sapiens) IF(Homo sapiens) IHC(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19577? Please let us know so that we can cite the reference in this datasheet.