제품 > 항체 > 다중클론항체(pAb)

Epcam Rabbit pAb (A23654)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Epcam Rabbit pAb (A23654) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	Epcam Rabbit pAb
Catalog No.	A23654
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable cadherin binding activity involved in cell-cell adhesion. Acts upstream of or within ureteric bud development. Located in cell surface. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Used to study congenital diarrhea 5 with tufting enteropathy. Human ortholog(s) of this gene implicated in congenital diarrhea 5 with tufting enteropathy and hereditary nonpolyposis colorectal cancer type 8. Orthologous to human EPCAM (epithelial cell adhesion molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-266 of mouse Epcam. (NP_032558.2).
Sequence	QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Gene ID
Swiss Prot
Synonyms	EGP; Ly74; gp40; CD326; EGP-2; TROP1; Egp314; Ep-CAM; EpCAM1; Tacsd1; GA733-2; Tacstd1; Epcam
Calculated MW	35kDa
Observed MW	35-40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HCT116, Mouse colon, Rat colon
Cellular location