제품 > 항체 > 단일클론항체(mAb)

CD326/EpCAM Rabbit mAb (A25344)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CD326/EpCAM Rabbit mAb (A25344) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): C2C12.
Exposure time: 20s.

ABclonal:Immunohistochemistry - CD326/EpCAM Rabbit mAb (A25344)

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using CD326/EpCAM Rabbit mAb (A25344) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using CD326/EpCAM Rabbit mAb (A25344) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human small intestine tissue using CD326/EpCAM Rabbit mAb (A25344) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - CD326/EpCAM Rabbit mAb (A25344)

Confocal imaging of paraffin-embedded Mouse small intestine tissue using CD326/EpCAM Rabbit mAb (A25344, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Mouse colon tissue using CD326/EpCAM Rabbit mAb (A25344, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Rat small intestine tissue using CD326/EpCAM Rabbit mAb (A25344, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

ABclonal:Flow CytoMetry - CD326/EpCAM Rabbit mAb (A25344)

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with CD326/EpCAM Rabbit mAb (A25344, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD326/EpCAM Rabbit mAb (A25344, 2 μg/mL, right).

Overview

Product name	CD326/EpCAM Rabbit mAb
Catalog No.	A25344
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65853

Background

Predicted to enable cadherin binding activity involved in cell-cell adhesion. Acts upstream of or within ureteric bud development. Located in cell surface. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Used to study congenital diarrhea 5 with tufting enteropathy. Human ortholog(s) of this gene implicated in congenital diarrhea 5 with tufting enteropathy and hereditary nonpolyposis colorectal cancer type 8. Orthologous to human EPCAM (epithelial cell adhesion molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-266 of mouse CD326/EpCAM (NP_032558.2).
Sequence	QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Gene ID
Swiss Prot
Synonyms	EGP; Ly74; gp40; CD326; EGP-2; TROP1; Egp314; Ep-CAM; EpCAM1; Tacsd1; GA733-2; Tacstd1
Calculated MW	35kDa
Observed MW	35-40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:3000 - 1:12000 IHC-P 1:500 - 1:5000 IF/ICC 1:200 - 1:2000 FC 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Flow Cytometry
Positive samples	Mouse colon
Cellular location	Lateral cell membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD326/EpCAM Rabbit mAb images

Western blot - CD326/EpCAM Rabbit mAb (A25344)

Immunohistochemistry - CD326/EpCAM Rabbit mAb (A25344)

Immunofluorescence - CD326/EpCAM Rabbit mAb (A25344)

Flow CytoMetry - CD326/EpCAM Rabbit mAb (A25344)

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or CD326/EpCAM Rabbit mAb (A25344, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.