제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Mouse CD326/EpCAM mAb (A25347)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Confocal imaging of paraffin-embedded Mouse colon tissue using ABflo® 594 Rabbit anti-Mouse CD326/EpCAM mAb (A25347, dilution 1:100). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Mouse small intestine tissue using ABflo® 594 Rabbit anti-Mouse CD326/EpCAM mAb (A25347, dilution 1:100). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Rat small intestine tissue using ABflo® 594 Rabbit anti-Mouse CD326/EpCAM mAb (A25347, dilution 1:100). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

ABclonal:Flow CytoMetry - ABflo® 594 Rabbit anti-Mouse CD326/EpCAM mAb (A25347)

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with ABflo® 594 Rabbit anti-Mouse CD326/EpCAM mAb (A25347, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD326/EpCAM mAb (A25347, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Mouse CD326/EpCAM mAb
Catalog No.	A25347
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65853-ABflo594

Background

Predicted to enable cadherin binding activity involved in cell-cell adhesion. Acts upstream of or within ureteric bud development. Located in cell surface. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Used to study congenital diarrhea 5 with tufting enteropathy. Human ortholog(s) of this gene implicated in congenital diarrhea 5 with tufting enteropathy and hereditary nonpolyposis colorectal cancer type 8. Orthologous to human EPCAM (epithelial cell adhesion molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-266 of mouse CD326/EpCAM (NP_032558.2).
Sequence	QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Gene ID
Swiss Prot
Synonyms	EGP; Ly74; gp40; CD326; EGP-2; TROP1; Egp314; Ep-CAM; EpCAM1; Tacsd1; GA733-2; Tacstd1
Calculated MW	35kDa
Observed MW

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Lateral cell membrane