Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Fatty Acid Synthase (FASN) Rabbit mAb (A19050) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Fatty Acid Synthase (FASN) Rabbit mAb (A19050) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Fatty Acid Synthase (FASN) Rabbit mAb (A19050) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse skin tissue using Fatty Acid Synthase (FASN) Rabbit mAb (A19050) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat fat tissue using Fatty Acid Synthase (FASN) Rabbit mAb (A19050) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of NIH/3T3 cells using Fatty Acid Synthase (FASN) Rabbit mAb (A19050) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using Fatty Acid Synthase (FASN) Rabbit mAb (A19050) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Fatty Acid Synthase (FASN) Rabbit mAb |
|---|---|
| Catalog No. | A19050 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0377 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human FASN (P49327). |
|---|---|
| Sequence | AVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | FAS; OA-519; SDR27X1; Fatty Acid Synthase (FASN) |
| Calculated MW | 273kDa |
| Observed MW | 273kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | A549, HeLa |
| Cellular location | Cytoplasm, Melanosome. |
| Customer validation | WB(Mus musculus, Homo sapiens) IHC(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19050? Please let us know so that we can cite the reference in this datasheet.
![[KO Validated] Fatty Acid Synthase (FASN) Rabbit mAb](https://img.abclonal.com/abclonal-manage/Catalog/A21182/A21182_1.jpg?t=1726630453)
![[KO Validated] Fatty Acid Synthase (FASN) Rabbit PolymAb®](https://img.abclonal.com/abclonal-manage/Catalog/A22462PM/A22462PM_1.jpg?t=1729063399)
