Reviews (3)Publications (6) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Monkey
Western blot analysis of various lysates using Fibrillarin/U3 RNP Rabbit pAb (A1136) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Immunofluorescence analysis of HeLa cells using Fibrillarin/U3 RNP Rabbit pAb (A1136) at dilution of 1:100. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of U-2OS cells using Fibrillarin/U3 RNP Rabbit pAb (A1136) at dilution of 1:200. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 1 μg Fibrillarin/U3 RNP antibody (A1136). Western blot was performed from the immunoprecipitate using Fibrillarin/U3 RNP antibody (A1136) at a dilution of 1:1000.
| Product name | Fibrillarin/U3 RNP Rabbit pAb |
|---|---|
| Catalog No. | A1136 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-321 of human Fibrillarin/U3 RNP (NP_001427.2). |
|---|---|
| Sequence | RGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN |
| Gene ID | |
| Swiss Prot | |
| Synonyms | FIB; FLRN; Nop1; RNU3IP1; Fibrillarin/U3 RNP |
| Calculated MW | 34kDa |
| Observed MW | 36kDa |
| Reactivity | Human, Mouse, Rat, Monkey |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | HeLa, A-375, U2OS, COS1, COS7, PC-12, Mouse brain, Mouse testis |
| Cellular location | Nucleus, nucleolus. |
| Customer validation | (Mouse ESC, HepG2) WB(Homo sapiens, Mus musculus) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A1136? Please let us know so that we can cite the reference in this datasheet.
