Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | Foxp3 Rabbit mAb |
---|---|
Catalog No. | A27090 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC68295 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of Mouse Foxp3 (NP_473380.1). |
---|---|
Sequence | MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPH |
Gene ID | |
Swiss Prot | |
Synonyms | sf; JM2; scurfin |
Calculated MW | 47kDa |
Observed MW | 47-55kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T |
Cellular location | Nucleus, Cytoplasm. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.