제품 > 항체 > 다중클론항체(pAb)

GPX4 Rabbit pAb (A13309)

Publications (18) Datasheet

Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat

ABclonal:Western blot - GPX4 Rabbit pAb (A13309)

Western blot analysis of lysates from Jurkat cells, using GPX4 Rabbit pAb (A13309) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - GPX4 Rabbit pAb (A13309)

Immunohistochemistry analysis of paraffin-embedded Rat testis using GPX4 Rabbit pAb (A13309) at dilution of 1:150 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - GPX4 Rabbit pAb (A13309)

Immunofluorescence analysis of NIH/3T3 cells using GPX4 Rabbit pAb (A13309) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product nameGPX4 Rabbit pAb
Catalog No.A13309
Host speciesRabbit
Purification methodAffinity purification
IsotypeIgG
The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a 'moonlighting' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Mutations in this gene are associated with Sedaghatian type of spondylometaphyseal dysplasia (SMDS). This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Transcript variants resulting from alternative splicing or use of alternate promoters have been described to encode isoforms with different subcellular localization.
ImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 30-197 of GPX4 (NP_002076.2).
SequenceASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Gene ID
Swiss Prot
SynonymsMCSP; SMDS; GPx-4; PHGPx; snGPx; GSHPx-4; snPHGPx
Calculated MW22kDa
Observed MW22kDa
ReactivityHuman, Mouse, Rat
Tested applicationsWBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage bufferStore at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key applicationWestern blotting    Immunohistochemistry    Immunofluorescence    
Positive samplesJurkat
Cellular locationCytoplasm, Mitochondrion.
Customer validation

WB(Homo sapiens, Rattus norvegicus, Mus musculus, Mus musculus, Gallus gallus)

IF(Mus musculus, Rattus norvegicus, Gallus gallus)

IHC(Homo sapiens, Mus musculus)

IF(Homo sapiens, Mus musculus)

WB(Gallus gallus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

ABclonal:Western blot - GPX4 Rabbit pAb (A13309)}

Western blot - GPX4 Rabbit pAb (A13309)

Western blot analysis of lysates from Jurkat cells, using GPX4 Rabbit pAb (A13309) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - GPX4 Rabbit pAb (A13309)}

Immunohistochemistry - GPX4 Rabbit pAb (A13309)

Immunohistochemistry analysis of paraffin-embedded Rat testis using GPX4 Rabbit pAb (A13309) at dilution of 1:150 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - GPX4 Rabbit pAb (A13309)}

Immunofluorescence - GPX4 Rabbit pAb (A13309)

Immunofluorescence analysis of NIH/3T3 cells using GPX4 Rabbit pAb (A13309) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.

Publishing research using A13309? Please let us know so that we can cite the reference in this datasheet.

항체 (4)

재조합 단백질 (1)

Secondary Antibodies (25)