Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | Glycophorin C (GYPC) Rabbit pAb |
---|---|
Catalog No. | A1232 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human Glycophorin C (Glycophorin C (GYPC)) (NP_002092.1). |
---|---|
Sequence | MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI |
Gene ID | |
Swiss Prot | |
Synonyms | GE; GPC; GPD; GYPD; CD236; PAS-2; CD236R; PAS-2' |
Calculated MW | 14kDa |
Observed MW | 34kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HepG2, HL-60, Mouse heart |
Cellular location | Cell membrane, Single-pass type III membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.