Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Neuropilin-1 (NRP1) Rabbit mAb |
---|---|
Catalog No. | A19087 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0488 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Neuropilin-1 (NRP1) (O14786). |
---|---|
Sequence | IDETGSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNTQSTYSEA |
Gene ID | |
Swiss Prot | |
Synonyms | NP1; NRP; BDCA4; CD304; VEGF165R; Neuropilin-1 (NRP1) |
Calculated MW | 103kDa |
Observed MW | 140kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse heart, Mouse kidney, Mouse lung, HUVEC, Rat heart, Rat lung |
Cellular location | Cell membrane, Secreted, Single-pass type I membrane protein. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19087? Please let us know so that we can cite the reference in this datasheet.