Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Glypican 3 (GPC3) Rabbit mAb |
---|---|
Catalog No. | A22608 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC56906 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 480-580 of human Glypican 3 (GPC3). (NP_004475.1). |
---|---|
Sequence | KGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH |
Gene ID | |
Swiss Prot | |
Synonyms | SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2; Glypican 3 (GPC3) |
Calculated MW | 66kDa |
Observed MW | Refer to figures |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HepG2 |
Cellular location | Cell membrane, Extracellular side, GPI-anchor, Lipid-anchor, Secreted, extracellular space. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.