제품 > 항체 > 단일클론항체(mAb)

Glypican 3 (GPC3) Rabbit mAb (A23410)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HepG2 cells using Glypican 3 (GPC3) Rabbit mAb (A23410) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - Glypican 3 (GPC3) Rabbit mAb (A23410)

Immunofluorescence analysis of HepG2 cells using Glypican 3 (GPC3) Rabbit mAb (A23410) at dilution of 1:300 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Flow CytoMetry - Glypican 3 (GPC3) Rabbit mAb (A23410)

Flow cytometry: 1X10^6 K-562 cells (negative control, left) and Hep G2 cells (right) were surface-stained with Glypican 3 (GPC3) Rabbit mAb (A23410, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Hep G2 cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or Glypican 3 (GPC3) Rabbit mAb (A23410, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Overview

Product name	Glypican 3 (GPC3) Rabbit mAb
Catalog No.	A23410
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC56916

Background

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 481-580 of human Glypican 3 (GPC3) (NP_004475.1).
Sequence	GRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH
Gene ID
Swiss Prot
Synonyms	SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2; Glypican 3 (GPC3)
Calculated MW	66kDa
Observed MW	66kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:100 - 1:500 FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Flow Cytometry
Positive samples	Hep G2
Cellular location	Cell membrane, Extracellular side, GPI-anchor, Lipid-anchor, Secreted, extracellular space
Customer validation	FC(Homo sapiens)