제품 > 항체 > 단일클론항체(mAb)

HDAC6 Rabbit mAb (A22169)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts from K-562 cells, using HDAC6 Rabbit mAb (A22169) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Overview

Product name	HDAC6 Rabbit mAb
Catalog No.	A22169
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55934

Background

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-700 of human HDAC6 (NP_006035.2).
Sequence	NGAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFT
Gene ID
Swiss Prot
Synonyms	HD6; JM21; CPBHM; PPP1R90
Calculated MW	131kDa
Observed MW	160kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	K-562
Cellular location	axon cytoplasm, caveola, centrosome, ciliary basal body, cytoplasm, cytosol, histone deacetylase complex, multivesicular body, nucleoplasm, nucleus, perinuclear region of cytoplasm