제품 > 항체 > 단일클론항체(mAb)

HDAC6 Rabbit mAb (A3572)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using HDAC6 Rabbit mAb (A3572) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - HDAC6 Rabbit mAb (A3572)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using HDAC6 Rabbit mAb (A3572) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunoprecipitation - HDAC6 Rabbit mAb (A3572)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg HDAC6 antibody (A3572). Western blot was performed from the immunoprecipitate using HDAC6 antibody (A3572) at a dilution of 1:1000.

Overview

Product name	HDAC6 Rabbit mAb
Catalog No.	A3572
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0805

Background

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC6 (Q9UBN7).
Sequence	MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCL
Gene ID
Swiss Prot
Synonyms	HD6; JM21; CPBHM; PPP1R90; HDAC6
Calculated MW	131kDa
Observed MW	160kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:100 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, Hep G2
Cellular location	Axon cytoplasm, Caveola, Centrosome, Ciliary basal body, Cytoplasm, Cytosol, Histone deacetylase complex, Multivesicular body, Nucleoplasm, Nucleus, Perinuclear region of cytoplasm.
Customer validation	WB(Homo sapiens)