제품 > 항체 > 단일클론항체(mAb)

IGF2BP1/IMP1 Rabbit mAb (A22612)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using IGF2BP1/IMP1 Rabbit mAb (A22612) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - IGF2BP1/IMP1 Rabbit mAb (A22612)

Immunofluorescence analysis of K-562 cells using IGF2BP1/IMP1 Rabbit mAb (A22612) at dilution of 1:400 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded rat kidney using IGF2BP1/IMP1 Rabbit mAb (A22612) at dilution of 1:400 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	IGF2BP1/IMP1 Rabbit mAb
Catalog No.	A22612
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57768

Background

This gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including insulin-like growth factor 2, beta-actin and beta-transducin repeat-containing protein, and regulating their translation. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IGF2BP1/IMP1 (NP_006537.3).
Sequence	MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSL
Gene ID
Swiss Prot
Synonyms	IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1; IGF2BP1/IMP1
Calculated MW	63kDa
Observed MW	63kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	K-562, Hep G2, NIH-3T3, K-562, rat kidney
Cellular location	CRD-mediated mRNA stability complex, cytoplasm, cytoplasmic stress granule, cytosol, dendritic spine, growth cone, nucleoplasm, nucleus, P-body, perinuclear region of cytoplasm